[AlexoTech] Amyloid-Beta Met 1-42 (1.0 mg) Human, Synthetic

[AlexoTech 한국공식대리점]

[AlexoTech] Amyloid-Beta Met 1-42 (1.0 mg) Human, Synthetic

Description:

• Article no.: AB-251-10
• Description: Synthetic Amyloid-Beta-peptide M 1-42
• Amount: 1mg
• Format: Lyophilized
• Molecular Weight: 4645 Da
• Sequence: MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
• Purity: 95% HPLC and SDS-PAGE
• Counter Ion: TFA (Trifluoracetic Acid)
• Storage: Store at -20°C upon arrival.

Product Citation:

• Lindhagen-Persson, M., Brännström, K., Vestling, M., Steinitz, M., & Olofsson, A. (2010). Amyloid-β oligomer specificity mediated by the IgM isotype--implications for a specific protective mechanism exerted by endogenous auto-antibodies. PloS one, 5(11), e13928. doi:10.1371/journal.pone.0013928
• Lindberg, D. J., Wranne, M. S., Gilbert Gatty, M., Westerlund, F., & Esbjörner, E. K. (2015). Steady-state and time-resolved Thioflavin-T fluorescence can report on morphological differences in amyloid fibrils formed by Aβ(1-40) and Aβ(1-42). Biochemical and Biophysical Research Communications, 458(2), 418–423. https://doi.org/10.1016/j.bbrc.2015.01.132 
• Olofsson, A., Lindhagen-Persson, M., Vestling, M., Sauer-Eriksson, A. E., & Öhman, A. (2009). Quenched hydrogen/deuterium exchange NMR characterization of amyloid-β peptide aggregates formed in the presence of Cu2+or Zn2+. FEBS Journal, 276(15), 4051–4060. https://doi.org/10.1111/j.1742-4658.2009.07113.x
• Brunetti, D., Torsvik, J., Dallabona, C., Teixeira, P., Sztromwasser, P., Fernandez-Vizarra, E., … Bindoff, L. A. (2015). Defective PITRM1 mitochondrial peptidase is associated with A  amyloidotic neurodegeneration. EMBO Molecular Medicine, 8(3), 176–190. https://doi.org/10.15252/emmm.201505894

어스바이오(USBIO)는 AlexoTech 한국 공식 대리점입니다.
해당 제품에 대한 문의나 AlexoTech 제품의 견적 또는 문의사항이 있으시면 아래로 연락주시기 바랍니다.
Tel : 02-862-2816 / email : bio@usbio.co.kr